PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G44180.2
Common NameRLT2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 1507aa    MW: 169583 Da    PI: 4.9804
Description Homeodomain-like transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G44180.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-181874157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                 ++kR   t+ qle+Le+ +  ++yps++ r++L+ kl+L++rq ++WF+ rR ke+k
  AT5G44180.2 18 KSKRKMKTAAQLEVLENTYSAEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLKERK 74
                 679****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-17474IPR009057Homeodomain-like
SuperFamilySSF466892.48E-151174IPR009057Homeodomain-like
PROSITE profilePS5007116.4391575IPR001356Homeobox domain
SMARTSM003896.8E-161779IPR001356Homeobox domain
CDDcd000863.19E-131875No hitNo description
PfamPF000465.9E-161874IPR001356Homeobox domain
SMARTSM005714.1E-23514573IPR018501DDT domain
PROSITE profilePS5082716.328514573IPR018501DDT domain
PfamPF027913.9E-17515570IPR018501DDT domain
PfamPF050668.8E-16696764IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.1E-6899937IPR028942WHIM1 domain
PfamPF156134.9E-710721119IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 1507 aa     Download sequence    Send to blast
MEGGSEKTTP EGCGGESKSK RKMKTAAQLE VLENTYSAEP YPSEAIRADL SVKLNLSDRQ  60
LQMWFCHRRL KERKSTTPSK RQRKELVTPT AMESWEPPVN AGDLVAGNEL DSRRAARGSG  120
GSGVTVVRRF NEPSSAEVRA IGYVEAQLGE RLRDNGPVLG MEFDPLPPGA FGMPIEMPSH  180
RKATRQAFET NIYVRSDVKP IKDHVRPIRE YQFIPELPSS RTDHSERVSP SHHFGVPLDG  240
SVMRVSAVSA GHRDDYKISP QIPNLNLATH QGKPGHVYSP NLVEYDSPYQ KSYMDTAAQV  300
HDDPFVKSER EVGNEDEDDD ALQLERHRKN EEARIAREVE AHEKRIRREL EKQDMLRRKR  360
EEQIRKEMER QDRERRKEEE RLLREKQREE ERYLKEQMRE LQRREKFLKK ETIRAEKMRQ  420
KEEMRKEKEV ARLKAANERA IARKIAKESM ELIEDERLEL MEVAALTKGL PSMLALDFET  480
LQNLDEYRDK QAIFPPTSVK LKKPFAVKPW NGSDENVANL LMVWRFLITF ADVLGLWPFT  540
LDEFAQAFHD YDPRLMGEIH IVLLKTIIKD IEGVVRTLST GVGANQNVAA NPGGGHPHVV  600
EGAYAWGFDI RSWRKNLNVF TWPEILRQLA LSAGLGPQLK KMNIRTVSVH DDNEANNSEN  660
VIFNLRKGVA AENAFAKMQE RGLSNPRRSR HRLTPGTVKF AAFHVLSLEG EKGLNILEVA  720
EKIQKSGLRD LTTSRTPEAS VAAALSRDTK LFERVAPSTY CVRASYRKDA GDAETIFAEA  780
RERIRAFKSG ITDVEDVDDA ERDEDSESDV GEDPEVDVNL KKEDPNPLKV ENLIGVEPLL  840
ENGKLDTVPM KTELGLPLTP SLPEEMKDEK RDDTLADQSL EDAVANGEDS ACFDESKLGE  900
QWVQGLVEGD YSNLSSEERL NALVALIGIA TEGNTIRIAL EERLEVASAL KKQMWGEVQL  960
DKRWKEESLI RANYLSYPTA KPGLNIATPA SGNQESSSAD VTPISSQDPV SLPQIDVNNV  1020
IAGPSLQLQE NVPGVENLQY QQQQGYTADR ERLRAQLKAY VGYKAEELYV YRSLPLGQDR  1080
RRNRYWRFSA SASRNDPGCG RIFVELQDGR WRLIDSEEAS LPPEGLEAFW TENLRKSWGM  1140
KLLSSSSHED LYQVLTTLEA ALKRDFLSSN FETTSELLGL QEGALASDLT CGVNVLPWIP  1200
KTAGGVALRL FDFDSSIVYT PDQNNDPLKD KESEDFVGLE TNILRNLHEK DVMETPVQVA  1260
AYKQEENWTD PGLGGVSSSG RGGRPPRGRG RPRARGNGKK PAVSVKPPRG AANSNGETML  1320
RPRAQPRGGR KNGRRSGTKG RKRPTQGTLG ICNEVGGGRR VKEVAVTAKT SLPDNDDDWI  1380
ETPELQDDDG EASSSGRSFQ YEDYDDDDVM APIDDFDGGG ESSKLVGRGE FSLHSDDEYE  1440
EEEEEEEDMN MKMDVNVVDD EDEDYINEDS YGRKQHGISI SNDAATRKRF NKFEDPDLTS  1500
SSSSDFQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
113291343RKNGRRSGTKGRKRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.249880.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184224140.0
Genevisible249086_at0.0
Expression AtlasAT5G44180-
AtGenExpressAT5G44180-
ATTED-IIAT5G44180-
Function -- GeneRIF ? help Back to Top
  1. Data indicate that transcriptional regulators RINGLET 2 (RLT2; AT5G44180) and AINTEGUMENTA-LIKE 5 (AIL5; At5g57390) as being essential for transgene phas transcription.
    [PMID: 23872538]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G44180.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G44180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0428930.0AY042893.1 Arabidopsis thaliana Unknown protein (MLN1.10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190470.10.0protein RINGLET2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLF4K8S90.0F4K8S9_ARATH; Homeodomain-like transcriptional regulator
STRINGAT5G44180.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Li F,Wu X,Tsang E,Cutler AJ
    Transcriptional profiling of imbibed Brassica napus seed.
    Genomics, 2005. 86(6): p. 718-30
    [PMID:16125897]
  3. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  4. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  5. Li G, et al.
    Imitation Switch chromatin remodeling factors and their interacting RINGLET proteins act together in controlling the plant vegetative phase in Arabidopsis.
    Plant J., 2012. 72(2): p. 261-70
    [PMID:22694359]
  6. Dong J, et al.
    SLIDE, the protein interacting domain of Imitation Switch remodelers, binds DDT-domain proteins of different subfamilies in chromatin remodeling complexes.
    J Integr Plant Biol, 2013. 55(10): p. 928-37
    [PMID:23691993]
  7. Sundaram S, et al.
    Gene networks and chromatin and transcriptional regulation of the phaseolin promoter in Arabidopsis.
    Plant Cell, 2013. 25(7): p. 2601-17
    [PMID:23872538]